GO:0032502 developmental process | "A biological process whose specific outcome is the progression of an... | 28 | 1 | GO:0007275 | multicellular organism development | "The biological process whose specific outcome is the progression of a... | 7 | 1 |
GO:0032501 | multicellular organismal process | "Any biological process, occurring at the level of a multicellular organism,... | 15 | 1 |
GO:0048856 | anatomical structure development | "The biological process whose specific outcome is the progression of an... | 17 | 1 |
GO:0090567 | reproductive shoot system development | "The process whose specific outcome is the progression of a reproductive... | 4 | 1 |
GO:0009791 | post-embryonic development | "The process whose specific outcome is the progression of the organism over... | 7 | 1 |
GO:0048608 | reproductive structure development | "The reproductive developmental process whose specific outcome is the... | 6 | 1 |
GO:0048731 | system development | "The process whose specific outcome is the progression of an organismal... | 4 | 1 |
GO:0009630 | gravitropism | "The orientation of plant parts under the stimulation of gravity." [ISBN:0198547684] | 3 | 1 |
GO:0009606 | tropism | "The movement of an organism, or part of an organism, in response to an... | 3 | 1 |
GO:0009629 | response to gravity | "Any process that results in a change in state or activity of a cell or an... | 3 | 1 |
GO:0009605 | response to external stimulus | "Any process that results in a change in state or activity of a cell or an... | 20 | 1 |
GO:0010074 | maintenance of meristem identity | "The process in which an organism retains a population of meristem cells,... | 1 | 1 |
GO:0019827 | stem cell population maintenance | "The process by which an organism or tissue maintains a population of stem... | 1 | 1 |
GO:0098727 | maintenance of cell number | "Any process by which the numbers of cells of a particular type or in a... | 1 | 1 |
GO:0009888 | tissue development | "The process whose specific outcome is the progression of a tissue over... | 3 | 1 |
GO:0010051 | xylem and phloem pattern formation | "The regionalization process that gives rise to the patterning of the... | 1 | 1 |
GO:0003002 | regionalization | "The pattern specification process that results in the subdivision of an... | 5 | 1 |
GO:0007389 | pattern specification process | "Any developmental process that results in the creation of defined areas or... | 6 | 1 |
GO:0006694 | steroid biosynthetic process | "The chemical reactions and pathways resulting in the formation of steroids,... | 4 | 1 |
GO:0016125 | sterol metabolic process | "The chemical reactions and pathways involving sterols, steroids with one or... | 2 | 1 |
GO:1901617 | organic hydroxy compound biosynthetic process | "The chemical reactions and pathways resulting in the formation of organic... | 11 | 1 |
GO:0008202 | steroid metabolic process | "The chemical reactions and pathways involving steroids, compounds with a... | 4 | 1 |
GO:0008610 | lipid biosynthetic process | "The chemical reactions and pathways resulting in the formation of lipids,... | 9 | 1 |
GO:1901615 | organic hydroxy compound metabolic process | "The chemical reactions and pathways involving organic hydroxy compound."... | 11 | 1 |
GO:0006629 | lipid metabolic process | "The chemical reactions and pathways involving lipids, compounds soluble in... | 10 | 1 |
GO:0044238 | primary metabolic process | "The chemical reactions and pathways involving those compounds which are... | 35 | 1 |
GO:0016829 | lyase activity | "Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means... | 2 | 1 |
GO:0043168 | anion binding | "Binding to an anion, a charged atom or group of atoms with a net negative... | 6 | 1 |
GO:0070279 | vitamin B6 binding | "Binding to a vitamin B6 compound: pyridoxal, pyridoxamine, pyridoxine, or... | 1 | 1 |
GO:0043167 | ion binding | "Binding to an ion, a charged atoms or groups of atoms." [GOC:jl] | 15 | 1 |
GO:0019842 | vitamin binding | "Binding to a vitamin, one of a number of unrelated organic substances that... | 1 | 1 |
GO:0097159 | organic cyclic compound binding | "Binding to an organic cyclic compound, any molecular entity that contains... | 27 | 1 |
GO:1901363 | heterocyclic compound binding | "Binding to heterocyclic compound." [GOC:TermGenie] | 27 | 1 |
GO:0005488 | binding | "The selective, non-covalent, often stoichiometric, interaction of a... | 58 | 1 |
GO:0036094 | small molecule binding | "Binding to a small molecule, any low molecular weight, monomeric,... | 12 | 1 |
GO:0009617 | response to bacterium | "Any process that results in a change in state or activity of a cell or an... | 13 | 1 |
GO:0098542 | defense response to other organism | "Reactions triggered in response to the presence of another organism that... | 13 | 1 |
GO:0051707 | response to other organism | "Any process that results in a change in state or activity of a cell or an... | 15 | 1 |
GO:0006952 | defense response | "Reactions, triggered in response to the presence of a foreign body or the... | 17 | 1 |
GO:0043207 | response to external biotic stimulus | "Any process that results in a change in state or activity of a cell or an... | 15 | 1 |
GO:0044419 | biological process involved in interspecies interaction between organisms | "Any process evolved to enable an interaction with an organism of a... | 15 | 1 |
GO:0006950 | response to stress | "Any process that results in a change in state or activity of a cell or an... | 34 | 1 |
GO:0009607 | response to biotic stimulus | "Any process that results in a change in state or activity of a cell or an... | 15 | 1 |
GO:0070546 | L-phenylalanine aminotransferase activity | "Catalysis of the transfer of an amino group from L-phenylalanine to an... | 1 | 1 |
GO:0099402 | plant organ development | "Development of a plant organ, a multi-tissue plant structure that forms a... | 9 | 1 |
GO:0048827 | phyllome development | "The process whose specific outcome is the progression of a phyllome over... | 5 | 1 |
GO:0048438 | floral whorl development | "The process whose specific outcome is the progression of a floral whorl... | 2 | 1 |
GO:0070529 | L-tryptophan aminotransferase activity | "Catalysis of the transfer of an amino group from L-tryptophan to an... | 1 | 1 |
GO:0010326 | methionine-oxo-acid transaminase activity | "Catalysis of the reaction: methionine + a 2-oxo acid =... | 2 | 1 |
GO:0070548 | L-glutamine aminotransferase activity | "Catalysis of the transfer of an amino group from L-glutamine to an... | 1 | 1 |
GO:0008793 | aromatic-amino-acid:2-oxoglutarate aminotransferase activity | "Catalysis of the reaction: an aromatic amino acid + 2-oxoglutarate = an... | 1 | 1 |
GO:0003700 | DNA-binding transcription factor activity | "A transcription regulator activity that modulates transcription of gene... | 36 | 1 |
GO:0005730 | nucleolus | "A small, dense body one or more of which are present in the nucleus of... | 2 | 1 |
GO:0006355 | regulation of DNA-templated transcription | "Any process that modulates the frequency, rate or extent of cellular... | 31 | 1 |
GO:0008270 | zinc ion binding | "Binding to a zinc ion (Zn)." [GOC:ai] | 5 | 1 |
GO:0010223 | secondary shoot formation | "The process that gives rise to secondary (or auxiliary or axillary) shoots... | 2 | 1 |
GO:0045893 | positive regulation of DNA-templated transcription | "Any process that activates or increases the frequency, rate or extent of... | 7 | 1 |
GO:0140110 | transcription regulator activity | "A molecular function that controls the rate, timing and/or magnitude of... | 38 | 1 |
GO:0043232 | intracellular non-membrane-bounded organelle | "Organized structure of distinctive morphology and function, not bounded by... | 6 | 1 |
GO:0043228 | non-membrane-bounded organelle | "Organized structure of distinctive morphology and function, not bounded by... | 6 | 1 |
GO:0010468 MAHPISCIVASLVILSAISFNVNVEATPSALFVFGDSYADTGNHDNDSVPVIYKPWRIPYGNTWPGKPSGRYSDGGVFTDYYAPYLGVAKPMPYRVVNSTTYDGSTGINFAFGGSGVILPIDAIHPNVSVQIDDLREAISEGLVSQELLNTSTVLLVLAGNDYTAYQAIDPDLENIDSFIAEVVEQMVVSLEALYELGFRSLTVANIGPVGCLPAITKANNYTSCLDTFNELGSLHNLLLASQMSNLQSNLSDADFVTLDFRTAFDVALQDGATNSTLPLRSCCEGINDESTCGEVDSDGSILYTVCSFVEEAFFWDEFHPTNAAWKAISNVLFNTSQNVYNPYLKKTEM* |